PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g014896m
Common NameCISIN_1g014896mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 417aa    MW: 45793.2 Da    PI: 6.4473
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g014896mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS416.42.6e-127403972374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lLl+cAeavs+++le+a+++L ++s+l++p+g++ qR+aayf eA++arl++s+ ++y+alp+ +++  ++++ ++a+++f+ +sP++kf
  orange1.1g014896m  40 LTLLLQCAEAVSADNLEEANKMLLEISQLSTPYGTSAQRVAAYFSEAMSARLVSSCLGIYAALPSLPQT--HTQKMVSAFQVFNGISPFVKF 129
                        579************************************************************999998..5899999************** PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                        sh+taNqaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s e+le+tg+rL++fAe+lg+pfef + va++
  orange1.1g014896m 130 SHFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SMEALEATGKRLSDFAEKLGLPFEFCP-VAEK 216
                        ********************************************************....***************************.7*** PP

               GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                        + +l++e+L+++++Ea+aV++    h+l+d ++s ++    +L l+++l Pkvv+vveq+++  ++sFl rf+ea++yysalfdsl a++++
  orange1.1g014896m 217 VGNLDPERLNISKREAVAVHWLQ--HSLYDVTGSDTN----TLCLLQRLAPKVVTVVEQDLSP-AGSFLGRFVEAIHYYSALFDSLGASYGE 301
                        **********************9..999999999999....********************98.899************************* PP

               GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                        eseer++vE++ll+rei+nv+a  g +r  + + +++Wre+l+++GFk ++l  +aa+qa lll +++ dgy++ e++g+l lgWkd  L++
  orange1.1g014896m 302 ESEERHVVEQQLLSREIRNVLAVGGPSRSGDVK-FHNWREKLQRSGFKGISLAGNAATQATLLLGMFPCDGYTLVEDNGTLKLGWKDLCLLT 392
                        ***************************888877.********************************************************** PP

               GRAS 370 vSaWr 374
                        +SaWr
  orange1.1g014896m 393 ASAWR 397
                        ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.65313377IPR005202Transcription factor GRAS
PfamPF035148.9E-12540397IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MTAATTAPTP PSLAVVNASI REKKEEIRQQ KRDEEGLHLL TLLLQCAEAV SADNLEEANK  60
MLLEISQLST PYGTSAQRVA AYFSEAMSAR LVSSCLGIYA ALPSLPQTHT QKMVSAFQVF  120
NGISPFVKFS HFTANQAIQE AFEREDRVHI IDLDIMQGLQ WPGLFHILAS RPGGPPYVRL  180
TGLGTSMEAL EATGKRLSDF AEKLGLPFEF CPVAEKVGNL DPERLNISKR EAVAVHWLQH  240
SLYDVTGSDT NTLCLLQRLA PKVVTVVEQD LSPAGSFLGR FVEAIHYYSA LFDSLGASYG  300
EESEERHVVE QQLLSREIRN VLAVGGPSRS GDVKFHNWRE KLQRSGFKGI SLAGNAATQA  360
TLLLGMFPCD GYTLVEDNGT LKLGWKDLCL LTASAWRPLI HHPCNNINAI STRYSH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-52393974375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.68950.0callus
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429683.10.0hypothetical protein CICLE_v10011085mg
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLA0A067FDQ50.0A0A067FDQ5_CITSI; Uncharacterized protein
TrEMBLV4S6380.0V4S638_9R
STRINGPOPTR_0016s15060.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81642640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein